GLP-1 (9-36) amide, CAS [[161748-29-4]]

Artikelnummer: ISC-GH-040
Artikelname: GLP-1 (9-36) amide, CAS [[161748-29-4]]
Artikelnummer: ISC-GH-040
Hersteller Artikelnummer: GH-040
Alternativnummer: ISC-GH-040
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
Alternative Synonym: Glucagon-like peptide-1 (9-36) amide
GLP-1 (9-36) amide, or Glucagon-like peptide-1 (9-36) amide, is a glucoregulatory peptide and the human N-terminally truncated major metabolite of glucagon-like peptide GLP-1 (7-36) amide, formed by dipeptidyl peptidase-IV (DPP IV) cleavage. GLP-1 (9-36) amide acts as an antagonist at the human GLP-1 receptor, inhibits hepatic glucose production and is a weak insulinotropic agent.
Molekulargewicht: 3089.4
NCBI: 1996
Reinheit: >95% by HPLC
Formulierung: Freeze dried solid
Sequenz: EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
CAS Nummer: [161748-29-4]
Formel: C140H214N36O43
Target-Kategorie: Glucagon and related receptors
Anwendungsbeschreibung: ProductType: Peptides