Oxyntomodulin, CAS [[62340-29-8]]

Artikelnummer: ISC-GH-070
Artikelname: Oxyntomodulin, CAS [[62340-29-8]]
Artikelnummer: ISC-GH-070
Hersteller Artikelnummer: GH-070
Alternativnummer: ISC-GH-070
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
Alternative Synonym: OXM, Glucagon 37
Oxyntomodulin is an endogenous glucagon-like peptide from the preproglucagon family that is secreted by intestinal L-cells. Oxyntomodulin binds to and activates the glucagon-like peptide (GLP-1) receptor, with its anorectic effects being blocked by the GLP-1 receptor antagonist exendin (9-39) and absent in GLP-1 receptor knockout mice. Oxyntomodulin modulates feeding and metabolism and inhibits gastric acid secretion.
Molekulargewicht: 4421.86
NCBI: 1981
Reinheit: >95% by HPLC
Formulierung: Freeze dried solid
Sequenz: HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
CAS Nummer: [62340-29-8]
Formel: C192H295N59O60S
Target-Kategorie: Glucagon and related receptors
Anwendungsbeschreibung: ProductType: Peptides