Peptide YY (3-36) (human), CAS [[126339-09-1]]

Artikelnummer: ISC-GH-120
Artikelname: Peptide YY (3-36) (human), CAS [[126339-09-1]]
Artikelnummer: ISC-GH-120
Hersteller Artikelnummer: GH-120
Alternativnummer: ISC-GH-120
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
PYY (3-36) is the N-terminal truncated metabolite of PYY1-36 and is released from the gastrointestinal tract postprandially in proportion to the calorie content of a meal. PYY(3-36) reduces appetite and inhibits food intake through action as a Y2 receptor agonist with IC50 values of 0.11 and 1050 nM for inhibition of 125I-PYY binding to Y2 and Y1 receptors respectively. Peptide YY (3-36) can inhibit food intake and reduce weight gain in vivo.
Molekulargewicht: 4049.6
NCBI: 2002
Reinheit: >95% by HPLC
Formulierung: Freeze dried solid
Sequenz: IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
CAS Nummer: [126339-09-1]
Formel: C180H279N53O54
Target-Kategorie: Neuropeptide Y receptors
Anwendungsbeschreibung: ProductType: Peptides