TIP 39

Artikelnummer: ISC-PH-020
Artikelname: TIP 39
Artikelnummer: ISC-PH-020
Hersteller Artikelnummer: PH-020
Alternativnummer: ISC-PH-020
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
Alternative Synonym: Tuberoinfundibular neuropeptide, Tuberoinfundibular peptide of 39 residues
TIP 39, or Tuberoinfundibular peptide of 39 residues, is a peptide that was first identified from bovine hypothalamus, which in humans is encoded by the PTH2 gene. TIP39 is related to parathyroid hormone and PTH-related protein and is a potent and selective agonist at parathyroid hormone 2 (PTH2) receptors. PTH2 receptors are highly expressed in the nervous system, and have roles in the modulation of pituitary function and in nociception.
Molekulargewicht: 4504.24
NCBI: 1999
Reinheit: >95%
Formulierung: Freeze dried solid
Sequenz: SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
Formel: C202H325N61O54S
Target-Kategorie: Parathyroid hormone receptors
Anwendungsbeschreibung: ProductType: Peptides