KP1

Artikelnummer: ISC-PP-290
Artikelname: KP1
Artikelnummer: ISC-PP-290
Hersteller Artikelnummer: PP-290
Alternativnummer: ISC-PP-290
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
Alternative Synonym: KP1 (human), Klotho-derived peptide 1
KP1 is a peptide representing the sequence Phe57 to Lys86 of the anti aging protein Klotho, and is one of the buried beta-strands in the N-terminal domain. KP1 mimics the anti-fibrotic action of Klotho by constraining TGF-beta signaling, KP1 acts through binding to TGF-beta receptor 2 (TbetaR2) and disrupting TGF-beta/TbetaR2 interaction. KP1 inhibits multiple downstream TGF-beta pathways including activation of Smad2/3 and mitogen activated protein kinases. In mouse models of renal fibrosis, KP1 preserves kidney function, ameliorates renal fibrosis and restores endogenous Klotho expression.
Molekulargewicht: 3228.48
NCBI: 2022
Reinheit: >95% by HPLC
Formulierung: Freeze dried solid
Sequenz: FQGTFPDGFLWAVGSAAYQTEGGWQQHGKG
Formel: C149H203N39O43
Target-Kategorie: Protein-protein interactions
Anwendungsbeschreibung: ProductType: Peptides