Bay 55-9837, CAS [[463930-25-8]]

Artikelnummer: ISC-VP-020
Artikelname: Bay 55-9837, CAS [[463930-25-8]]
Artikelnummer: ISC-VP-020
Hersteller Artikelnummer: VP-020
Alternativnummer: ISC-VP-020
Hersteller: Isca Biochemicals
Kategorie: Biochemikalien
Bay 55-9837 is a selective vasoactive intestinal peptide receptor 2 (VPAC2 receptor) agonist, binding to VPAC2 with a Kd of 0.65 nmol/l and having greater than 100-fold selectivity over VPAC1. BAY 55-9837 stimulates glucose-dependent insulin secretion in isolated pancreatic islets, increases insulin synthesis in rat islets, and causes a dose-dependent increase in plasma insulin levels in fasted rats. BAY 55-9837 raises survival motor neuron (SMN) protein levels through pharmacological modulation of the SMN2 gene and ameliorates disease phenotype in severe spinal muscular atrophy mouse models
Molekulargewicht: 3742.29
NCBI: 2002
Reinheit: >95% by hplc
Formulierung: Freeze dried solid
Sequenz: HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY-NH2
CAS Nummer: [463930-25-8]
Formel: C167H270N52O46
Target-Kategorie: Vasoactive intestinal peptide (VIP) receptors
Anwendungsbeschreibung: ProductType: Peptides