IHC-plus(TM) Polyclonal Rabbit anti-Human Calgizzarin / S100A11 Antibody (IHC, IF, WB) LS-B14896

Produktübersicht

• Artikelname: IHC-plus(TM) Polyclonal Rabbit anti-Human Calgizzarin / S100A11 Antibody (IHC, IF, WB) LS-B14896
• Artikelnummer: LS-B14896-50
• Hersteller Artikelnummer: LS-B14896-50
• Alternativnummer: LS-B14896-50
• Hersteller: LifeSpan Biosciences
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IF, IHC, IHC-P, WB
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human S100A11 (NP_005611.1). MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT
• Konjugation: Unconjugated
• Alternative Synonym: S100A11, Calgizzarin, MLN 70, MLN70, Protein S100-A11, Protein S100-C, S100C

Produktbeschreibung

S100A11 antibody LS-B14896 is an unconjugated rabbit polyclonal antibody to S100A11 (Calgizzarin) from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB. Tested on 20 paraffin-embedded human tissues.

Produkteigenschaften

• Klonalität: Polyclonal
• NCBI: 6282
• Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Reinheit: Affinity purified
• Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Anwendungsbeschreibung

• Application Verdünnung: IF (1:50 - 1:200), IHC (1:50 - 1:200), IHC-P (1:200), WB (1:500 - 1:2000)
• Anwendungsbeschreibung: The predicted MW is 11kDa, while the observed MW by Western blot was 12kDa.

Bilder

Western blot analysis of extracts of various cell lines, using S100A11 antibody.

Immunofluorescence analysis of U20S cell using S100A11 antibody. Blue: DAPI for nuclear staining.

Immunohistochemistry of paraffin-embedded human kidney tissue.