Polyclonal Rabbit anti-Human BAX Antibody (IHC, IF, WB) LS-C330831

Produktübersicht

• Artikelname: Polyclonal Rabbit anti-Human BAX Antibody (IHC, IF, WB) LS-C330831
• Artikelnummer: LS-C330831-20
• Hersteller Artikelnummer: LS-C330831-20
• Alternativnummer: LS-C330831-20
• Hersteller: LifeSpan Biosciences
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IF, IHC, WB
• Spezies Reaktivität: Human, Mouse
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human BAX (NP_620116.1). MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMF
• Konjugation: Unconjugated
• Alternative Synonym: BAX, BCL2-associated X protein, Bcl2-L-4, Apoptosis regulator BAX, Bcl-2-like protein 4, BCL2L4

Produktbeschreibung

BAX antibody LS-C330831 is an unconjugated rabbit polyclonal antibody to BAX from human. It is reactive with human and mouse. Validated for IF, IHC and WB.

Produkteigenschaften

• Klonalität: Polyclonal
• NCBI: 581
• Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Reinheit: Affinity purified
• Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Anwendungsbeschreibung

• Application Verdünnung: IF, IHC (1:50 - 1:100), WB (1:500 - 1:2000)
• Anwendungsbeschreibung: The predicted MW is 4kDa/12kDa/15kDa/18kDa/19kDa/21kDa/24kDa, while the observed MW by Western blot was 21kDa.

Bilder

Western blot analysis of extract