Polyclonal Rabbit anti-Human Histone H3 Antibody (IHC, IF, WB) LS-C332079

Artikelnummer: LS-C332079-20
Artikelname: Polyclonal Rabbit anti-Human Histone H3 Antibody (IHC, IF, WB) LS-C332079
Artikelnummer: LS-C332079-20
Hersteller Artikelnummer: LS-C332079-20
Alternativnummer: LS-C332079-20
Hersteller: LifeSpan Biosciences
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ChIP, IF, IHC, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50 to the C-Terminus of human HIST3H3 (NP_003484.1). REIRRYQKSTELLIRKLPFQRLMREIAQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNLCVIHAKRVTIMPKDIQLARRIRGERA
Konjugation: Unconjugated
Histone H3 antibody LS-C332079 is an unconjugated rabbit polyclonal antibody to Histone H3 from human. It is reactive with human, mouse and rat. Validated for ChIP-Seq, ChrIP, IF, IHC, IP and WB.
Klonalität: Polyclonal
Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit: Affinity purified
Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Verdünnung: ChIP-Seq (1:50 - 1:200), ChrIP, IF (1:50 - 1:200), IHC (1:50 - 1:200), IP (1:20 - 1:50), WB (1:500 - 1:2000)
Anwendungsbeschreibung: The predicted MW is 15kDa, while the observed MW by Western blot was 17kDa.
Western blot analysis of extracts of various cells.
Immunohistochemistry of paraffin-embedded Rat liver tissue.
Immunoprecipitation analysis of 150ug extracts of MCF7 cells.