Polyclonal Rabbit anti-Human DBH/Dopamine Beta Hydroxylase Antibody (WB) LS-C332224

Produktübersicht

• Artikelname: Polyclonal Rabbit anti-Human DBH/Dopamine Beta Hydroxylase Antibody (WB) LS-C332224
• Artikelnummer: LS-C332224-20
• Hersteller Artikelnummer: LS-C332224-20
• Alternativnummer: LS-C332224-20
• Hersteller: LifeSpan Biosciences
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 150-250 of human DBH (NP_000778.3). PFGTCDPKDYLIEDGTVHLVYGILEEPFRSLEAINGSGLQMGLQRVQLLKPNIPEPELPSDACTMEVQAPNIQIPSQETTYWCYIKELPKGFSRHHIIKYE
• Konjugation: Unconjugated
• Alternative Synonym: DBH, DBM, Dopamine beta-hydroxylase

Produktbeschreibung

Dopamine Beta Hydroxylase antibody LS-C332224 is an unconjugated rabbit polyclonal antibody to Dopamine Beta Hydroxylase (DBH) from human. It is reactive with human, mouse and rat. Validated for WB.

Produkteigenschaften

• Klonalität: Polyclonal
• NCBI: 1621
• Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Reinheit: Affinity purified
• Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Anwendungsbeschreibung

• Application Verdünnung: WB (1:500 - 1:1000)
• Anwendungsbeschreibung: The predicted MW is 69kDa, while the observed MW by Western blot was 79kDa.

Bilder

Western blot analysis of extracts of various cells.