Polyclonal Rabbit anti-Human NEUROG3 / NGN3 / Neurogenin 3 Antibody (WB) LS-C332242

Produktübersicht

• Artikelname: Polyclonal Rabbit anti-Human NEUROG3 / NGN3 / Neurogenin 3 Antibody (WB) LS-C332242
• Artikelnummer: LS-C332242-100
• Hersteller Artikelnummer: LS-C332242-100
• Alternativnummer: LS-C332242-100
• Hersteller: LifeSpan Biosciences
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human, Mouse
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-83 of human NEUROG3 (NP_066279.2). MTPQPSGAPTVQVTRETERSFPRASEDEVTCPTSAPPSPTRTRGNCAEAEEGGCRGAPRKLRARRGGRSRPKSELALSKQRRS
• Konjugation: Unconjugated
• Alternative Synonym: NEUROG3, BHLHa7, Atoh5, Math4B, Neurogenin-3, NGN-3, Ngn3, Neurogenin 3, Protein atonal homolog 5

Produktbeschreibung

Neurogenin 3 antibody LS-C332242 is an unconjugated rabbit polyclonal antibody to Neurogenin 3 (NEUROG3 / NGN3) from human. It is reactive with human and mouse. Validated for WB.

Produkteigenschaften

• Klonalität: Polyclonal
• NCBI: 50674
• Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Reinheit: Affinity purified
• Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Anwendungsbeschreibung

• Application Verdünnung: WB (1:500 - 1:1000)
• Anwendungsbeschreibung: The predicted MW is 23kDa, while the observed MW by Western blot was 23kDa.

Bilder

Western blot analysis of extracts of mouse testis tissue, using NEUROG3 antibody.