Polyclonal Rabbit anti-Human PGC / Pepsin C Antibody (IHC, WB) LS-C332246

Produktübersicht

• Artikelname: Polyclonal Rabbit anti-Human PGC / Pepsin C Antibody (IHC, WB) LS-C332246
• Artikelnummer: LS-C332246-100
• Hersteller Artikelnummer: LS-C332246-100
• Alternativnummer: LS-C332246-100
• Hersteller: LifeSpan Biosciences
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC, WB
• Spezies Reaktivität: Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human PGC (NP_001159896.1). PSVYCQSQACTSHSRFNPSESSTYSTNGQTFSLQYGSGSLTGFFGYDTLTVQSIQVPNQEFGLSENEPGTNFVYAQFDGIMGLAYPALSVDEATTAMQGMV
• Konjugation: Unconjugated
• Alternative Synonym: PGC, Gastricsin, Pepsinogen II, Pepsin C, Progastricsin, Pepsinogen group II, PGII, Preprogastricsin, Urinary pepsinogen 1, Pepsinogen C, Progastricsin (pepsinogen C)

Produktbeschreibung

Pepsin C antibody LS-C332246 is an unconjugated rabbit polyclonal antibody to Pepsin C (PGC) from human. It is reactive with mouse and rat. Validated for IHC and WB.

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 1.89 mg/ml
• NCBI: 5225
• Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Reinheit: Affinity purified
• Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Anwendungsbeschreibung

• Application Verdünnung: IHC (1:50 - 1:100), WB (1:500 - 1:2000)
• Anwendungsbeschreibung: The predicted MW is 34kDa/42kDa, while the observed MW by Western blot was 45-50kDa.

Bilder

Western blot analysis of extracts of various cell lines, using PGC antibody.