Polyclonal Rabbit anti-Human UTS2R / GPR14 Antibody (WB) LS-C332300

Produktübersicht

• Artikelname: Polyclonal Rabbit anti-Human UTS2R / GPR14 Antibody (WB) LS-C332300
• Artikelnummer: LS-C332300-20
• Hersteller Artikelnummer: LS-C332300-20
• Alternativnummer: LS-C332300-20
• Hersteller: LifeSpan Biosciences
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 280-389 of human UTS2R (NP_061822.1). LAQYHQAPLAPRTARIVNYLTTCLTYGNSCANPFLYTLLTRNYRDHLRGRVRGPGSGGGRGPVPSLQPRARFQRCSGRSLSSCSPQPTDSLVLAPAAPARPAPEGPRAPA
• Konjugation: Unconjugated
• Alternative Synonym: UTS2R, G protein-coupled receptor 14, GPR14, G-protein coupled receptor 14, UII-receptor, Urotensin 2 receptor, UT-II, UTR, UTR2, Uii-r, UR-2-R, Senr, Uii-r1a, Uiir, UR-II-R, Urotensin II receptor, Urotensin-2 receptor

Produktbeschreibung

GPR14 antibody LS-C332300 is an unconjugated rabbit polyclonal antibody to GPR14 (UTS2R) from human. It is reactive with human, mouse and rat. Validated for WB.

Produkteigenschaften

• Klonalität: Polyclonal
• NCBI: 2837
• Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Reinheit: Affinity purified
• Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Anwendungsbeschreibung

• Application Verdünnung: WB (1:500 - 1:2000)
• Anwendungsbeschreibung: The predicted MW is 42kDa, while the observed MW by Western blot was 42kDa.

Bilder

Western blot analysis of extracts of Mouse fetal muscle tissue lysate.