SNRPE Antibody LS-C334087, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: SNRPE Antibody LS-C334087, Unconjugated, Polyclonal
• Artikelnummer: LS-C334087-20
• Hersteller Artikelnummer: LS-C334087-20
• Alternativnummer: LS-C334087-20
• Hersteller: LifeSpan Biosciences
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IF, IHC, WB
• Spezies Reaktivität: Human, Mouse
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human SNRPE (NP_003085.1). MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN
• Konjugation: Unconjugated
• Alternative Synonym: SNRPE, B-raf, Sm protein E, SME, SnRNP-E, Sm-E

Produktbeschreibung

SNRPE antibody LS-C334087 is an unconjugated rabbit polyclonal antibody to SNRPE from human. It is reactive with human and mouse. Validated for IF, IHC and WB.

Produkteigenschaften

• Klonalität: Polyclonal
• NCBI: 6635
• Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Reinheit: Affinity purified
• Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Anwendungsbeschreibung

• Application Verdünnung: IF (1:50 - 1:200), IHC (1:50 - 1:200), WB (1:500 - 1:2000)
• Anwendungsbeschreibung: The predicted MW is 10kDa, while the observed MW by Western blot was 11kDa.

Bilder

Western blot analysis of extracts of various cell lines.

Immunohistochemistry of paraffin-embedded human kidney tissue.

Immunofluorescence analysis of U20S cells.