TUSC2 / FUS1 Antibody LS-C335709, Unconjugated, Rabbit, Polyclonal

Produktübersicht

• Artikelname: TUSC2 / FUS1 Antibody LS-C335709, Unconjugated, Rabbit, Polyclonal
• Artikelnummer: LS-C335709-20
• Hersteller Artikelnummer: LS-C335709-20
• Alternativnummer: LS-C335709-20
• Hersteller: LifeSpan Biosciences
• Wirt: Rabbit
• Kategorie: Antikörper
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human TUSC2 (NP_009206.1). MGASGSKARGLWPFASAAGGGGSEAAGAEQALVRPRGRAVPPFVFTRRGSMFYDEDGDLAHEFYEETIVTKNGQKRAKLRRVHKNLIPQGIVKLDHPRIHVDFPVILYEV
• Konjugation: Unconjugated
• Alternative Synonym: TUSC2, C3orf11, Fus-1 protein, FUS1, Fusion 1 protein, LGCC, PAP, PDAP2, PDGFA-associated protein 2, PDGFA associated protein 2, Tumor suppressor candidate 2

Produkteigenschaften

• Klonalität: Polyclonal
• NCBI: 11334
• Reinheit: Affinity purified
• Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Anwendungsbeschreibung

• Anwendungsbeschreibung: IF (1:50 - 1:100), IHC (1:50 - 1:200), WB (1:500 - 1:2000)

Bilder

Immunohistochemistry of paraffin-embedded rat brain tissue.

Immunofluorescence analysis of U2OS cells.