Monoclonal Mouse anti-Toxoplasma gondii Toxoplasma gondii VP1 Antibody (Preservative Free, Biotin, WB) LS-C343091

Artikelnummer: LS-C343091-50
Artikelname: Monoclonal Mouse anti-Toxoplasma gondii Toxoplasma gondii VP1 Antibody (Preservative Free, Biotin, WB) LS-C343091
Artikelnummer: LS-C343091-50
Hersteller Artikelnummer: LS-C343091-50
Alternativnummer: LS-C343091-50
Hersteller: LifeSpan Biosciences
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Parasite
Immunogen: Recombinant protein of Toxoplasma gondii VP1. Immunogen Sequence: YTKAADVGADLSGKNEYGMSEDDPRNPAC.
Konjugation: Biotin
Toxoplasma gondii VP1 antibody LS-C343091 is a biotin-conjugated mouse monoclonal antibody to toxoplasma gondii Toxoplasma gondii VP1. Validated for ELISA and WB.
Klonalität: Monoclonal
Isotyp: IgG1
Puffer: Lyophilized from PBS, No preservatives added
Reinheit: Protein A + Protein G affinity chromatography
Formulierung: Lyophilized from PBS, No preservatives added
Application Verdünnung: ELISA (1:160000), WB (1:1000 - 1:5000)
Anwendungsbeschreibung: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested.