Polyclonal Rabbit anti-Human FRA-1 / FOSL1 Antibody (IHC, IF, WB) LS-C346075

Artikelnummer: LS-C346075-20
Artikelname: Polyclonal Rabbit anti-Human FRA-1 / FOSL1 Antibody (IHC, IF, WB) LS-C346075
Artikelnummer: LS-C346075-20
Hersteller Artikelnummer: LS-C346075-20
Alternativnummer: LS-C346075-20
Hersteller: LifeSpan Biosciences
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IF, IHC, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human FOSL1 (NP_005429.1). MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLGPSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQI
Konjugation: Unconjugated
Alternative Synonym: FOSL1, FOS-like antigen 1, Fos-related antigen 1, FRA, FOS-like antigen-1, FRA1, Fra-1
FOSL1 antibody LS-C346075 is an unconjugated rabbit polyclonal antibody to FOSL1 (FRA-1) from human. It is reactive with human and mouse. Validated for IF, IHC and WB.
Klonalität: Polyclonal
NCBI: 8061
Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit: Affinity purified
Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Verdünnung: IF (1:50 - 1:100), IHC (1:50 - 1:200), WB (1:500 - 1:2000)
Anwendungsbeschreibung: The predicted MW is 17kDa/29kDa, while the observed MW by Western blot was 39kDa.
Immunofluorescence analysis of HeLa cell using FOSL1 antibody. Blue: DAPI for nuclear staining.
Western blot analysis of extracts of various cells.
Immunohistochemistry of paraffin-embedded mouse liver tissue.