MSTN / GDF8 / Myostatin Antibody LS-C348992, Unconjugated, Rabbit, Polyclonal

Produktübersicht

• Artikelname: MSTN / GDF8 / Myostatin Antibody LS-C348992, Unconjugated, Rabbit, Polyclonal
• Artikelnummer: LS-C348992-100
• Hersteller Artikelnummer: LS-C348992-100
• Alternativnummer: LS-C348992-100
• Hersteller: LifeSpan Biosciences
• Wirt: Rabbit
• Kategorie: Antikörper
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 267-375 of human MSTN (NP_005250.1). DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
• Konjugation: Unconjugated
• Alternative Synonym: MSTN, GDF8, MSLHP, Myostatin, GDF-8

Produkteigenschaften

• Klonalität: Polyclonal
• NCBI: 2660
• Reinheit: Affinity purified
• Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Anwendungsbeschreibung

• Anwendungsbeschreibung: IHC (1:50 - 1:100), WB (1:500 - 1:2000)

Bilder

Western blot analysis of extracts of various cell lines.

Immunohistochemistry of paraffin-embedded mouse lung tissue.