MSTN / GDF8 / Myostatin Antibody LS-C348992, Unconjugated, Rabbit, Polyclonal

Artikelnummer: LS-C348992-20
Artikelname: MSTN / GDF8 / Myostatin Antibody LS-C348992, Unconjugated, Rabbit, Polyclonal
Artikelnummer: LS-C348992-20
Hersteller Artikelnummer: LS-C348992-20
Alternativnummer: LS-C348992-20
Hersteller: LifeSpan Biosciences
Wirt: Rabbit
Kategorie: Antikörper
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 267-375 of human MSTN (NP_005250.1). DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Konjugation: Unconjugated
Alternative Synonym: MSTN, GDF8, MSLHP, Myostatin, GDF-8
Klonalität: Polyclonal
NCBI: 2660
Reinheit: Affinity purified
Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Anwendungsbeschreibung: IHC (1:50 - 1:100), WB (1:500 - 1:2000)
Western blot analysis of extracts of various cell lines.
Immunohistochemistry of paraffin-embedded mouse lung tissue.