Polyclonal Rabbit anti-Human PRDM5 Antibody (IHC, IF, WB) LS-C349088

Artikelnummer: LS-C349088-20
Artikelname: Polyclonal Rabbit anti-Human PRDM5 Antibody (IHC, IF, WB) LS-C349088
Artikelnummer: LS-C349088-20
Hersteller Artikelnummer: LS-C349088-20
Alternativnummer: LS-C349088-20
Hersteller: LifeSpan Biosciences
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IF, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human PRDM5 (NP_061169.2). MLGMYVPDRFSLKSSRVQDGMGLYTARRVRKGEKFGPFAGEKRMPEDLDENMDYRLMWEVRGSKGEVLYILDATNPRHSNWLRFVHEAPSQEQKNLAAIQ
Konjugation: Unconjugated
Alternative Synonym: PRDM5, BCS2, PFM2, PR domain containing 5, PR domain-containing protein 5
PRDM5 antibody LS-C349088 is an unconjugated rabbit polyclonal antibody to PRDM5 from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB.
Klonalität: Polyclonal
NCBI: 11107
Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit: Affinity purified
Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Verdünnung: IF (1:50 - 1:200), IHC (1:50 - 1:200), WB (1:500 - 1:2000)
Anwendungsbeschreibung: The predicted MW is 12kDa/58kDa/69kDa/73kDa, while the observed MW by Western blot was 110kDa.
Western blot of extracts of various cell lines, using PRDM5 antibody.
Immunohistochemistry of paraffin-embedded rat spleen tissue.
Immunofluorescence analysis of A549 cells.