Polyclonal Rabbit anti-Human ITGA2B / CD41 Antibody (aa677-711, IHC, WB) LS-C407859

Produktübersicht

• Artikelname: Polyclonal Rabbit anti-Human ITGA2B / CD41 Antibody (aa677-711, IHC, WB) LS-C407859
• Artikelnummer: LS-C407859-100
• Hersteller Artikelnummer: LS-C407859-100
• Alternativnummer: LS-C407859-100
• Hersteller: LifeSpan Biosciences
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC, IHC-P, WB
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence at the C-Terminus of human ITGA2B (677-711 aa EAELAVHLPQGAHYMRALSNVEGFERLICNQKKEN), different from the related mouse sequence by four amino acids.
• Konjugation: Unconjugated
• Alternative Synonym: ITGA2B, BDPLT2, CD41B, GT, gp2B, Integrin alpha-IIb, ITGAB, GPIIb, HPA3, Platelet-specific antigen BAK, CD41, CD41 antigen, GPalpha IIb, GTA

Produktbeschreibung

CD41 antibody LS-C407859 is an unconjugated rabbit polyclonal antibody to CD41 (ITGA2B) (aa677-711) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.

Produkteigenschaften

• Klonalität: Polyclonal
• NCBI: 3674
• Puffer: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
• Reinheit: Immunogen affinity purified
• Formulierung: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.

Anwendungsbeschreibung

• Application Verdünnung: IHC, IHC-P (0.5 - 1 µg/ml), WB (0.1 - 0.5 µg/ml)
• Anwendungsbeschreibung: IHC: Antigen retrieval by boiling the paraffin sections in 10 mM citrate buffer, pH6.0, for 20 minutes is required for the staining of formalin/paraffin sections.

Bilder

ITGA2B antibody IHC-paraffin. IHC(P): Mouse Lung Tissue.