Polyclonal Rabbit anti-Human DNAJB2 Antibody (WB) LS-C497053

Produktübersicht

• Artikelname: Polyclonal Rabbit anti-Human DNAJB2 Antibody (WB) LS-C497053
• Artikelnummer: LS-C497053-20
• Hersteller Artikelnummer: LS-C497053-20
• Alternativnummer: LS-C497053-20
• Hersteller: LifeSpan Biosciences
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human, Mouse
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 215-324 of human DNAJB2 (NP_006727.2). GLELSRREQQPSVTSRSGGTQVQQTPASCPLDSDLSEDEDLQLAMAYSLSEMEAAGKKPAGGREAQHRRQGRPKAQHQDPGLGGTQEGARGEATKRSPSPEEKASRCLIL
• Konjugation: Unconjugated
• Alternative Synonym: DNAJB2, DSMA5, DnaJ protein homolog 1, HSPF3, Heat shock 40 kDa protein 3, Heat shock protein J1, Dnaj protein homolog hsj1, HSJ-1, HSJ1

Produktbeschreibung

DNAJB2 antibody LS-C497053 is an unconjugated rabbit polyclonal antibody to DNAJB2 from human. It is reactive with human and mouse. Validated for WB.

Produkteigenschaften

• Klonalität: Polyclonal
• NCBI: 3300
• Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Reinheit: Affinity purified
• Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Anwendungsbeschreibung

• Application Verdünnung: WB (1:200 - 1:2000)
• Anwendungsbeschreibung: The predicted MW is 30kDa/35kDa, while the observed MW by Western blot was 42kDa.