Polyclonal Rabbit anti-Human SLC39A14 / ZIP14 Antibody (WB) LS-C497121

Produktübersicht

• Artikelname: Polyclonal Rabbit anti-Human SLC39A14 / ZIP14 Antibody (WB) LS-C497121
• Artikelnummer: LS-C497121-20
• Hersteller Artikelnummer: LS-C497121-20
• Alternativnummer: LS-C497121-20
• Hersteller: LifeSpan Biosciences
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 240-340 of human SLC39A14 (NP_001128626.1). ILKILLKQKNEHHHGHSHYASESLPSKKDQEEGVMEKLQNGDLDHMIPQHCSSELDGKAPMVDEKVIVGSLSVQDLQASQSACYWLKGVRYSDIGTLAWMI
• Konjugation: Unconjugated
• Alternative Synonym: SLC39A14, KIAA0062, LZT-Hs4, NET34, Zrt-, Irt-like protein 14, Zinc transporter ZIP14, ZIP-14, ZIP14, Zrt- and Irt-like protein 14, Cig19

Produktbeschreibung

ZIP14 antibody LS-C497121 is an unconjugated rabbit polyclonal antibody to human ZIP14 (SLC39A14). Validated for WB.

Produkteigenschaften

• Klonalität: Polyclonal
• NCBI: 23516
• Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Reinheit: Affinity purified
• Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Anwendungsbeschreibung

• Application Verdünnung: WB (1:500 - 1:2000)
• Anwendungsbeschreibung: The predicted MW is 52kDa/54kDa, while the observed MW by Western blot was 50kDa.