Polyclonal Rabbit anti-Human TNFRSF10A / DR4 Antibody (IHC, WB) LS-C661881
Artikelnummer:
LS-C661881-100
| Artikelname: |
Polyclonal Rabbit anti-Human TNFRSF10A / DR4 Antibody (IHC, WB) LS-C661881 |
| Artikelnummer: |
LS-C661881-100 |
| Hersteller Artikelnummer: |
LS-C661881-100 |
| Alternativnummer: |
LS-C661881-100 |
| Hersteller: |
LifeSpan Biosciences |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
FC, ICC, IHC, WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
A synthetic peptide corresponding to a sequence at the N-Terminus of human DR4 (99-131 aa VLLQVVPSSAATIKLHDQSIGTQQWEHSPLGEL). |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
TNFRSF10A, APO2, CD261, DR4, TRAIL-R1, TRAILR-1, TRAILR1, TRAIL receptor 1, CD261 antigen, Cytotoxic TRAIL receptor, Death receptor 4 |
| DR4 antibody LS-C661881 is an unconjugated rabbit polyclonal antibody to human DR4 (TNFRSF10A). Validated for Flow, ICC, IHC and WB. |
| Klonalität: |
Polyclonal |
| NCBI: |
8797 |
| Puffer: |
Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose |
| Reinheit: |
Immunogen affinity purified |
| Formulierung: |
Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose |
| Application Verdünnung: |
Flo, ICC, IHC, WB |
| Anwendungsbeschreibung: |
Flo, ICC, IHC, WB |
![]()
|
Western blot - Anti-DR4 Picoband Antibody |
