Polyclonal Rabbit anti-Human MDC1 Antibody (WB) LS-C747801

Produktübersicht

• Artikelname: Polyclonal Rabbit anti-Human MDC1 Antibody (WB) LS-C747801
• Artikelnummer: LS-C747801-20
• Hersteller Artikelnummer: LS-C747801-20
• Alternativnummer: LS-C747801-20
• Hersteller: LifeSpan Biosciences
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human, Mouse
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MDC1 (NP_055456.2). MEDTQAIDWDVEEEEETEQSSESLRCNVEPVGRLHIFSGAHGPEKDFPLHLGKNVVGRMPDCSVALPFPSISKQHAEIEILAWDKAPILRDCGSLNGTQI
• Konjugation: Unconjugated
• Alternative Synonym: MDC1, Em:AB023051.5, NFBD1, KIAA0170

Produktbeschreibung

MDC1 antibody LS-C747801 is an unconjugated rabbit polyclonal antibody to MDC1 from human. It is reactive with human and mouse. Validated for WB.

Produkteigenschaften

• Klonalität: Polyclonal
• NCBI: 9656
• Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Reinheit: Affinity purified
• Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Anwendungsbeschreibung

• Application Verdünnung: WB (1:500 - 1:2000)
• Anwendungsbeschreibung: The predicted MW is 116kDa/195kDa/197kDa/226kDa, while the observed MW by Western blot was 200kDa.