Polyclonal Rabbit anti-Human c-Maf Antibody (WB) LS-C747804

Artikelnummer: LS-C747804-20
Artikelname: Polyclonal Rabbit anti-Human c-Maf Antibody (WB) LS-C747804
Artikelnummer: LS-C747804-20
Hersteller Artikelnummer: LS-C747804-20
Alternativnummer: LS-C747804-20
Hersteller: LifeSpan Biosciences
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 314-403 of human MAF (NP_005351.2). HVLESEKNQLLQQVDHLKQEISRLVRERDAYKEKYEKLVSSGFRENGSSSDNPSSPEFFITEPTRKLEPSVGYATFWKPQHRVLTSVFTK
Konjugation: Unconjugated
Alternative Synonym: MAF, C-MAF, CCA4, C-maf proto-oncogene, Proto-oncogene c-Maf, T lymphocyte c-maf long form, Transcription factor Maf
C-Maf antibody LS-C747804 is an unconjugated rabbit polyclonal antibody to c-Maf from human. It is reactive with human, mouse and rat. Validated for WB.
Klonalität: Polyclonal
NCBI: 4094
Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit: Affinity purified
Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Verdünnung: WB (1:1000 - 1:2000)
Anwendungsbeschreibung: The predicted MW is 38kDa/41kDa, while the observed MW by Western blot was 38kDa.