Polyclonal Rabbit anti-Human SLC25A19 Antibody (WB) LS-C747808

Produktübersicht

• Artikelname: Polyclonal Rabbit anti-Human SLC25A19 Antibody (WB) LS-C747808
• Artikelnummer: LS-C747808-20
• Hersteller Artikelnummer: LS-C747808-20
• Alternativnummer: LS-C747808-20
• Hersteller: LifeSpan Biosciences
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human, Mouse
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human SLC25A19 (NP_068380.3). MVGYDPKPDGRNNTKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQHERLSRSDPSAKYHGILQASRQILQEEGPTAFWK
• Konjugation: Unconjugated
• Alternative Synonym: SLC25A19, DNC, THMD4, MCPHA, TPC, Microcephaly, Amish, THMD3

Produktbeschreibung

SLC25A19 antibody LS-C747808 is an unconjugated rabbit polyclonal antibody to SLC25A19 from human. It is reactive with human and mouse. Validated for WB.

Produkteigenschaften

• Klonalität: Polyclonal
• NCBI: 60386
• Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Reinheit: Affinity purified
• Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Anwendungsbeschreibung

• Application Verdünnung: WB (1:1000 - 1:2000)
• Anwendungsbeschreibung: The predicted MW is 29kDa/35kDa.