Polyclonal Rabbit anti-Human CNTN3 / Contactin 3 Antibody (WB) LS-C749739

Produktübersicht

• Artikelname: Polyclonal Rabbit anti-Human CNTN3 / Contactin 3 Antibody (WB) LS-C749739
• Artikelnummer: LS-C749739-100
• Hersteller Artikelnummer: LS-C749739-100
• Alternativnummer: LS-C749739-100
• Hersteller: LifeSpan Biosciences
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 20-110 of human CNTN3 (NP_065923.1). ELLLQGPVFIKEPSNSIFPVGSEDKKITLHCEARGNPSPHYRWQLNGSDIDMSMEHRYKLNGGNLVVINPNRNWDTGTYQCFATNSLGTIV
• Konjugation: Unconjugated
• Alternative Synonym: CNTN3, BIG-1, KIAA1496, PANG, PCS, Contactin-3

Produktbeschreibung

Contactin 3 antibody LS-C749739 is an unconjugated rabbit polyclonal antibody to Contactin 3 (CNTN3) from human. It is reactive with human, mouse and rat. Validated for WB.

Produkteigenschaften

• Klonalität: Polyclonal
• NCBI: 5067
• Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Reinheit: Affinity purified
• Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Anwendungsbeschreibung

• Application Verdünnung: WB (1:500 - 1:2000)
• Anwendungsbeschreibung: The predicted MW is 112kDa, while the observed MW by Western blot was 113kDa.