Neuropeptide Y / NPY Antibody LS-C750049, Unconjugated, Rabbit, Polyclonal

Produktübersicht

• Artikelname: Neuropeptide Y / NPY Antibody LS-C750049, Unconjugated, Rabbit, Polyclonal
• Artikelnummer: LS-C750049-20
• Hersteller Artikelnummer: LS-C750049-20
• Alternativnummer: LS-C750049-20
• Hersteller: LifeSpan Biosciences
• Wirt: Rabbit
• Kategorie: Antikörper
• Spezies Reaktivität: Human
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-97 of human NPY (NP_000896.1). MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW
• Konjugation: Unconjugated
• Alternative Synonym: NPY, Pro-neuropeptide Y, Neuropeptide Y, PYY4

Produkteigenschaften

• Klonalität: Polyclonal
• NCBI: 4852
• Reinheit: Affinity purified
• Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Anwendungsbeschreibung

• Anwendungsbeschreibung: IF (1:50 - 1:200)