Polyclonal Rabbit anti-Human RNF125 / TRAC-1 Antibody (WB) LS-C750136

Produktübersicht

• Artikelname: Polyclonal Rabbit anti-Human RNF125 / TRAC-1 Antibody (WB) LS-C750136
• Artikelnummer: LS-C750136-20
• Hersteller Artikelnummer: LS-C750136-20
• Alternativnummer: LS-C750136-20
• Hersteller: LifeSpan Biosciences
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human RNF125 (NP_060301.2). MGSVLSTDSGKSAPASATARALERRRDPELPVTSFDCAVCLEVLHQPVRTRCGHVFCRSCIATSLKNNKWTCPYCRAYLPSEGVPATDVAKRMKSEYKNCAECDT
• Konjugation: Unconjugated
• Alternative Synonym: RNF125, RING finger protein 125, TRAC-1, TRAC1

Produktbeschreibung

TRAC-1 antibody LS-C750136 is an unconjugated rabbit polyclonal antibody to human TRAC-1 (RNF125). Validated for WB.

Produkteigenschaften

• Klonalität: Polyclonal
• NCBI: 54941
• Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Reinheit: Affinity purified
• Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Anwendungsbeschreibung

• Application Verdünnung: WB (1:500 - 1:2000)
• Anwendungsbeschreibung: The predicted MW is 26kDa, while the observed MW by Western blot was 28kDa.