Polyclonal Rabbit anti-Human CCS Antibody (IHC, WB) LS-C782764

Produktübersicht

• Artikelname: Polyclonal Rabbit anti-Human CCS Antibody (IHC, WB) LS-C782764
• Artikelnummer: LS-C782764-100
• Hersteller Artikelnummer: LS-C782764-100
• Alternativnummer: LS-C782764-100
• Hersteller: LifeSpan Biosciences
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC-P, WB
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: Amino acids 174-209 (DADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGR) from the human protein were used as the immunogen for the CCS antibody.
• Konjugation: Unconjugated
• Alternative Synonym: CCS

Produktbeschreibung

CCS antibody LS-C782764 is an unconjugated rabbit polyclonal antibody to CCS from human. It is reactive with human, mouse and rat. Validated for IHC and WB.

Produkteigenschaften

• Klonalität: Polyclonal
• NCBI: 9973
• Puffer: Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
• Reinheit: Antigen Affinity purification
• Formulierung: Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.

Anwendungsbeschreibung

• Application Verdünnung: IHC-P (1 - 2 µg/ml), WB (0.5 - 1 µg/ml)
• Anwendungsbeschreibung: Optimal dilution of the CCS antibody should be determined by the researcher.