SARS-CoV-2 NSP12 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA20233T
Artikelname: SARS-CoV-2 NSP12 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA20233T
Hersteller Artikelnummer: CNA20233T
Alternativnummer: MBL-CNA20233T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Virus
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of coronavirus NSP12 (YP_009725307.1).
Konjugation: Unconjugated
Alternative Synonym: sars-cov-2
Klonalität: Polyclonal
Molekulargewicht: 794kDa
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: GIVGVLTLDNQDLNGNWYDFGDFIQTTPGSGVPVVDSYYSLLMPILTLTRALTAESHVDTDLTKPYIKWDLLKYDFTEERLKLFDRYFKYWDQTYHPNCVN
Target-Kategorie: NSP12
Application Verdünnung: WB,1:2000 - 1:6000