SARS-CoV-2 Spike S2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
MBL-CNA20284P
Artikelname: |
SARS-CoV-2 Spike S2 Rabbit pAb, Unconjugated, Polyclonal |
Artikelnummer: |
MBL-CNA20284P |
Hersteller Artikelnummer: |
CNA20284P |
Alternativnummer: |
MBL-CNA20284P |
Hersteller: |
MBL |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
IP, WB |
Spezies Reaktivität: |
Virus |
Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 1174-1273 of SARS-CoV-2 Spike S2 (YP_009724390.1). |
Konjugation: |
Unconjugated |
Alternative Synonym: |
sars-cov-2 |
Klonalität: |
Polyclonal |
Molekulargewicht: |
141kDa |
Quelle: |
Rabbit |
Reinheit: |
Affinity purification |
Formulierung: |
PBS with 0.05% proclin300,50% glycerol |
Sequenz: |
ASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT |
Target-Kategorie: |
Spike S2 |
Application Verdünnung: |
WB,1:500 - 1:1000|IP,1:1000 - 1:5000 |