SARS-CoV-2 NSP9 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA20308T
Artikelname: SARS-CoV-2 NSP9 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA20308T
Hersteller Artikelnummer: CNA20308T
Alternativnummer: MBL-CNA20308T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Virus
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-113 of coronavirus NSP9 (YP_009742616.1).
Konjugation: Unconjugated
Alternative Synonym: sars-cov-2
Klonalität: Polyclonal
Molekulargewicht: 794kDa
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1-113 of coronavirus NSP9 (YP_009742616.1).
Application Verdünnung: WB,1:2000 - 1:6000