SARS-CoV-2 ORF6 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
MBL-CNA20324P
| Artikelname: |
SARS-CoV-2 ORF6 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: |
MBL-CNA20324P |
| Hersteller Artikelnummer: |
CNA20324P |
| Alternativnummer: |
MBL-CNA20324P |
| Hersteller: |
MBL |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Virus |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-61 of coronavirus ORF6 (YP_009724394.1). |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
sars-cov-2 |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
7kDa |
| Quelle: |
Rabbit |
| Reinheit: |
Affinity purification |
| Formulierung: |
PBS with 0.05% proclin300,50% glycerol |
| Sequenz: |
MFHLVDFQVTIAEILLIIMRTFKVSIWNLDYIINLIIKNLSKSLTENKYSQLDEEQPMEID |
| Target-Kategorie: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-61 of coronavirus ORF6 (YP_009724394.1). |
| Application Verdünnung: |
WB,1:500 - 1:1000 |
