UBE2Q2 Antibody / Ubiquitin carrier protein Q2, Rabbit, Polyclonal

Artikelnummer: NSJ-R32289
Artikelname: UBE2Q2 Antibody / Ubiquitin carrier protein Q2, Rabbit, Polyclonal
Artikelnummer: NSJ-R32289
Hersteller Artikelnummer: R32289
Alternativnummer: NSJ-R32289
Hersteller: NSJ Bioreagents
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Amino acids LERLEDTKNNNLLRQQLKWLICELCSLYNLPKHLDVEMLDQ of human UBE2Q2 were used as the immunogen for the UBE2Q2 antibody.
UBE2Q2 is identified as a putative ubiquitin-conjugating enzyme (E2) in a microarray screen for mitotic regulatory proteins. Its gene is mapped to 15q24.2. It can covalently bind ubiquitin on the active site cysteine within the UBC domain. Inhibition of UBE2Q2 in HeLa cells causes an early mitotic arrest and increases cytotoxicity when the cells are treated with microtubule-inhibiting agents (MIAs). Changes in cell cycle progression and viability are not observed in the absence of MIA treatment, indicating that UBE2Q2 is involved in the response to MIAs rather than performing a more general function in mitosis. Moreover, inhibition of the protein causes cells to undergo a prolonged prophase arrest, suggesting that UBE2Q2 normally functions to antagonize an early mitotic checkpoint. Finally, inhibition of UBE2Q2 also sensitizes cells to the cytotoxic effects of MIAs through caspase-mediated apoptosis that is correlated with PARP1 cleavage.
Klonalität: Polyclonal
Konzentration: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Isotyp: Rabbit IgG
UniProt: Q8WVN8
Puffer: Lyophilized from 1X PBS with 2% Trehalose
Reinheit: Antigen affinity
Formulierung: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Target-Kategorie: UBE2Q2
Antibody Type: Primary Antibody
Application Verdünnung: Western blot: 0.5-1ug/ml,Flow cytometry: 1-3ug/million cells
Anwendungsbeschreibung: Optimal dilution of the UBE2Q2 antibody should be determined by the researcher.
IHC testing of FFPE human lung cancer tissue with UBE2Q2 antibody. HIER: Boil the para