Amino acids DDEEYYRMELLAKEFQDKTAPRLQKYLVLK of human CPT1B were used as the immunogen for the CPT1B antibody.
CPT1B is located on 22q13.33. The protein encoded by this gene, a member of the carnitine/ choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria. This enzyme is required for the net transport of long-chain fatty acyl-CoAs from the cytoplasm into the mitochondria. Multiple transcript variants encoding different isoforms have been found for this gene, and read-through transcripts are expressed from the upstream locus that include exons from this gene.
Klonalität:
Polyclonal
Konzentration:
0.5mg/ml if reconstituted with 0.2ml sterile DI water
