[beta]-Amyloid (1-39)

Artikelnummer: PEL-EP10043_1
Artikelname: [beta]-Amyloid (1-39)
Artikelnummer: PEL-EP10043_1
Hersteller Artikelnummer: EP10043_1
Alternativnummer: PEL-EP10043_1
Hersteller: peptides and elephants
Kategorie: Proteine/Peptide
Applikation: ELISpot, FACS, FC, FluoroSpot, IHC, WB
Spezies Reaktivität: Human
A number of Aß protein variants, differing only at their carboxy terminus (1-39, 1-40, 1-42 and 1-43), are identified as the major components of the cerebral amyloid deposits in Alzheimers disease. The length of the C-terminus is a critical determinant
Reinheit: 95%
Sequenz: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV