Anti-BNP-32 Antibody, Polyclonal

Artikelnummer: RAY-RB-13-0001-20
Artikelname: Anti-BNP-32 Antibody, Polyclonal
Artikelnummer: RAY-RB-13-0001-20
Hersteller Artikelnummer: RB-13-0001-20
Alternativnummer: RAY-RB-13-0001-20
Hersteller: RayBiotech
Kategorie: Antikörper
Spezies Reaktivität: Human
Immunogen: The imunogen was synthetic peptide. This antibody was produced from a rabbit immunized with the immunogen. The IgG fraction was purified from rabbit serum followed by Protein A/G affinity chromatography.
Rabbit Anti-Human BNP-32 Antibody
Klonalität: Polyclonal
NCBI: 4879
UniProt: P16860
Sequenz: SPKMVQGSGCFGRKMDRSSSSGLGCKVLRRH
Anwendungsbeschreibung: ELISA (recommended work dilution= 1:2000)