Anti-NPF Antibody, Polyclonal

Artikelnummer: RAY-RB-19-0001-500
Artikelname: Anti-NPF Antibody, Polyclonal
Artikelnummer: RAY-RB-19-0001-500
Hersteller Artikelnummer: RB-19-0001-500
Alternativnummer: RAY-RB-19-0001-500
Hersteller: RayBiotech
Kategorie: Antikörper
Spezies Reaktivität: Human
Immunogen: Immunogen is a synthetic peptide derived from Drosophila Neuropeptide F. This antibody was produced from a rabbit immunized with the immunogen. The IgG fraction was purified from rabbit serum by ammonium sulphate precipitation, and followed by Protein A/G affinity chromatography.
Rabbit Anti-NPF Antibody
Klonalität: Polyclonal
UniProt: NP_536741
Sequenz: CSNSRPPRKNDVNTMADAYKFLQDLDTYYGDRARVRF
Anwendungsbeschreibung: ELISA (recommended work dilution= 1: 1,000-5,000)