Anti-NPF Receptor (N-term) Antibody, Polyclonal

Artikelnummer: RAY-RB-19-0003-200
Artikelname: Anti-NPF Receptor (N-term) Antibody, Polyclonal
Artikelnummer: RAY-RB-19-0003-200
Hersteller Artikelnummer: RB-19-0003-200
Alternativnummer: RAY-RB-19-0003-200
Hersteller: RayBiotech
Kategorie: Antikörper
Immunogen: Immunogen is a synthetic peptide derived from Drosophila Neuropeptide F. This antibody was produced from a rabbit immunized with the immunogen. The IgG fraction was purified from rabbit serum by ammonium sulphate precipitation, and followed by Protein A/G affinity chromatography.
Rabbit Anti-NPF Receptor (N-terminus) Antibody
Klonalität: Polyclonal
UniProt: NP_524245
Sequenz: YNKLKSRITVVAVQASSAQRKVERGRRMKRTNC
Anwendungsbeschreibung: ELISA (recommended work dilution= 1: 1,000-5,000)