RM IL-19

Artikelnummer: SHD-200-75-10UG
Artikelname: RM IL-19
Artikelnummer: SHD-200-75-10UG
Hersteller Artikelnummer: 200-75-10UG
Alternativnummer: SHD-200-75-10UG
Hersteller: Fujifilm Irvine Scientific
Kategorie: Proteine/Peptide
Applikation: Bioassay, SDS-PAGE
Spezies Reaktivität: Mouse
Interleukin-19 (IL-19) is a member of the interleukin 10 (IL-10) cytokine family and is produced by B cells and monocytes. IL-19 binds the interleukin 20 receptor complex (IL-20R) to activate STAT3 signaling. IL-19 induces interleukin 6 (IL-6) and tumor
Molekulargewicht: 17.7
UniProt: Q8CJ70
Puffer: 10 mM Sodium Phosphate, 50 mM Sodium Chloride, pH 7.5
Quelle: E.coli
Reinheit: 95
Formulierung: Lyophilized from a 0.2 µm filtered solution
Sequenz: MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA
Anwendungsbeschreibung: Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.