RM IL-19

Produktübersicht

• Artikelname: RM IL-19
• Artikelnummer: SHD-200-75-500UG
• Hersteller Artikelnummer: 200-75-500UG
• Alternativnummer: SHD-200-75-500UG
• Hersteller: Fujifilm Irvine Scientific
• Kategorie: Proteine/Peptide
• Applikation: Bioassay, SDS-PAGE
• Spezies Reaktivität: Mouse

Produktbeschreibung

Interleukin-19 (IL-19) is a member of the interleukin 10 (IL-10) cytokine family and is produced by B cells and monocytes. IL-19 binds the interleukin 20 receptor complex (IL-20R) to activate STAT3 signaling. IL-19 induces interleukin 6 (IL-6) and tumor

Produkteigenschaften

• Molekulargewicht: 17.7
• UniProt: Q8CJ70
• Puffer: 10 mM sodium phosphate, 50 mM sodium chloride, pH 7.5
• Quelle: E.coli
• Reinheit: 95
• Formulierung: Lyophilized from a 0.2 µm filtered solution
• Sequenz: MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA

Anwendungsbeschreibung

• Anwendungsbeschreibung: Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.