SARS-CoV-2 (COVID-19) Nucleocapsid protein, His-Tag, E. coli

Artikelnummer: TRZ-P2020-010_1000
Artikelname: SARS-CoV-2 (COVID-19) Nucleocapsid protein, His-Tag, E. coli
Artikelnummer: TRZ-P2020-010_1000
Hersteller Artikelnummer: P2020-010_1000
Alternativnummer: TRZ-P2020-010_1000
Hersteller: trenzyme
Wirt: E. coli
Kategorie: Biochemikalien
Applikation: ELISA, WB
Spezies Reaktivität: Virus
Alternative Synonym: coronavirus NP Protein, 2019-nCoV, coronavirus Nucleocapsid Protein, coronavirus Nucleoprotein Protein, cov np Protein, ncov NP Protein, N Protein, NCP-CoV Nucleocapsid Protein, novel coronavirus NP Protein, novel coronavirus Nucleocapsid Protein, novel coronavirus Nucleoprotein Protein, np Protein, nucleocapsid Protein, Nucleoprotein Protein, covid-19, sars-cov-2
Beneath its envelope membrane, the new coronavirus SARS-CoV-2 consists of a icosaedric nucleocapsid that contains its genectic information in form of positive sensed single-stranded RNA. The RNA is contained in a nucleoprotein complex, consisting of the SARS-CoV-2 (COVID-19) Nucleocapsid protein. This phosphoprotein is necessary to keep the capsid in its helical symmetry and aids with packaging into the viral capsid by acting as a molecular RNA chaperone. Together with the matrix (M) protein, the N-protein is one of the most abundant proteins in the viral particle, it is important for viral replication and is also known for modulating cellular signalling. It is highly immunogenic and its sequence is very conserved, therefore it is an attractive target for diagnostic purposes.
Molekulargewicht: 50,0 kDa
UniProt: P0DTC9
Puffer: PBS
Reinheit: > 85% as determined by SDS-PAGE
Formulierung: liquid
Sequenz: MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHG KEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAG LPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGS QASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQ QQGQTVTKKSA
Formel: pH 7,4
SDS-Page of Nucleocapsid protein His-Tag
Structural model of Nucleocapsid protein His-Tag
Histogram of Nucleocapsid protein His-Tag