SARS-CoV-2 (COVID-19) 3CL-Mpro Protein, unmodified, E. coli

Artikelnummer: TRZ-P2020-027_100
Artikelname: SARS-CoV-2 (COVID-19) 3CL-Mpro Protein, unmodified, E. coli
Artikelnummer: TRZ-P2020-027_100
Hersteller Artikelnummer: P2020-027_100
Alternativnummer: TRZ-P2020-027_100
Hersteller: trenzyme
Wirt: E. coli
Kategorie: Biochemikalien
Applikation: ELISA, FA, WB
Spezies Reaktivität: Virus
Alternative Synonym: 3CL Mpro, 3CL Pro, 3CL protease, 3C-like main protease, SARS-CoV-2, coronavirus, 2019-nCoV, COVID-2019, COVID-19, covid-19, sars-cov-2
The new coronavirus SARS-CoV-2 expresses two proteases, the papain-like protease (PLpro) and 3C-like protease (3CLpro). Both belong to the group of cysteine proteases, as they have a cysteine residue at their catalytic site. Their main function is the pr
Molekulargewicht: 33,8 kDa
UniProt: P0DTD1
Puffer: 20 mM Tris, 150 mM NaCl, 1 mM DTT, 20% (v/v) Glyverol
Reinheit: > 90% as determined by SDS-PAGE
Formulierung: liquid
Sequenz: SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE PLTQDHVDIL
Formel: pH 7.5
SDS-Page of 3CL-Mpro Protein unmodified
Structural model of 3CL-Mpro Protein unmodified
Histogram of 3CL-Mpro Protein unmodified
SDS-Page of 3CL-Mpro Protein unmodified