SARS-CoV-2 (COVID 19) Spike S1 Protein (RBD), Tag-removed

Artikelnummer: TRZ-P2020-028_1000
Artikelname: SARS-CoV-2 (COVID 19) Spike S1 Protein (RBD), Tag-removed
Artikelnummer: TRZ-P2020-028_1000
Hersteller Artikelnummer: P2020-028_1000
Alternativnummer: TRZ-P2020-028_1000
Hersteller: trenzyme
Kategorie: Biochemikalien
Applikation: ELISA, FA, WB
Spezies Reaktivität: Virus
Alternative Synonym: SARS-CoV-2, coronavirus, SARS-CoV-2 spike RBD, SARS-CoV-2 spike protein, 2019-nCoV, COVID-2019, COVID-19, covid, sars-cov-2
The spike (S) glycoprotein of coronaviruses is essential for binding of the virus to the host cell at the beginning of the infection process. The severe acute respiratory syndrome-coronavirus (SARS-CoV) spike (S) glycoprotein is responsible for membrane fusion and is therefore required for virus entry and cell fusion. The target protein is also a major immunogen and a possible target for entry inhibitors. The SARS-CoV-2 spike (S) protein is a large type I transmembrane protein composed of two subunits, S1 and S2. The S1 subunit contains a receptor-binding domain (RBD) responsible for binding to the host cell receptor angiotensin-converting enzyme 2 (ACE2). The S2 subunit mediates fusion between the viral and host cell membranes. The S1 RBD protein plays key parts in the induction of neutralizing-antibody and T-cell responses, as well as protective immunity.
Molekulargewicht: 25,8 kDa
UniProt: P0DTC2
Puffer: PBS
Reinheit: > 85% as determined by SDS-PAGE
Formulierung: liquid
Sequenz: MRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYA DSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAG STPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
Formel: pH 7,4
Structural model of Spike S1 RBD Tag-removed
Histogram of Spike S1 RBD Tag-removed
SDS-Page of Spike S1 RBD Tag-removed