SARS-CoV-2 S1 (RBD) Kappa B.1.617.1 (India), Fc/His-Tag

Artikelnummer: TRZ-P2020-047_100
Artikelname: SARS-CoV-2 S1 (RBD) Kappa B.1.617.1 (India), Fc/His-Tag
Artikelnummer: TRZ-P2020-047_100
Hersteller Artikelnummer: P2020-047_100
Alternativnummer: TRZ-P2020-047_100
Hersteller: trenzyme
Kategorie: Biochemikalien
Spezies Reaktivität: Virus
Alternative Synonym: L452R), 501.V2, VUI-202012/01, B.1.617, B1617, B.1.617.1, B16171, B.1.617.2, B16172, B.1.617.3, B16173, Indian Variant, , E484Q, L452R, SARS-CoV-2, coronavirus, SARS-CoV-2 spike RBD, SARS-CoV-2 spike protein, 2019-nCoV, COVID-2019, COVID-19, RBD (E484Q,
The spike (S) glycoprotein of coronaviruses is essential for binding of the virus to the host cell at the beginning of the infection process. The target protein is also a major immunogen and a possible target for entry inhibitors. The SARS-CoV-2 spike (S) protein is a large type I transmembrane protein composed of two subunits, S1 and S2. The S1 subunit contains a receptor-binding domain (RBD) responsible for binding to the host cell receptor angiotensin-converting enzyme 2 (ACE2). Several mutants of the spike protein are known. A new SARS-CoV-2 lineage called B.1.617, exhibits 13 mutations. Compared to the previously circulating variants, the mutations L452R and E484Q of the SARS-CoV-2 Spike S1 (RBD) may cause a stronger affinity of the spike protein to hACE2 and also conferring an increasing ability to evade the hosts’ immune system.
Molekulargewicht: 38,9 kDa
UniProt: P0DTC2
Puffer: PBS
Reinheit: > 90% as determined by SDS-PAGE
Formulierung: liquid
Sequenz: MRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTF KCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWN SNNLDSKVGGNYNYrYRLFRKSNLKPFERDISTEIYQAGSTPCNGVqGFNCYFPLQSYGF QPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
Formel: pH 7,4
Structural model of SARS-CoV-2 S1 (RBD) Kappa B1.617.1 (India) Fc His-Tag
Histogram of SARS-CoV-2 S1 (RBD) Kappa B1.617.1 (India) Fc His-Tag
SDS-Page of SARS-CoV-2 S1 (RBD) Kappa B1.617.1 (India) Fc His-Tag