hCELA3A, GFP/His-Tag

Artikelnummer: TRZ-P2020-108_100
Artikelname: hCELA3A, GFP/His-Tag
Artikelnummer: TRZ-P2020-108_100
Hersteller Artikelnummer: P2020-108_100
Alternativnummer: TRZ-P2020-108_100
Hersteller: trenzyme
Kategorie: Biochemikalien
Applikation: ELISA, FA, WB
Spezies Reaktivität: Human
Alternative Synonym: Chymotrypsin-like elastase family member 3A, Elastase IIIA, Elastase-3A, ELA3, ELA3A, Protease E, OTTHUMP00000002835, elastase 3A, pancreatic
Chymotrypsin-like elastases (CELAs) are pancreatic serine proteinases, which belong to the peptidase S1 family, a subfamily of serine proteases. The human CELA3A is a member of the elastase family, which consists of six human elastase genes encoding the proteins elastase 1, 2, 2A, 2B, 3A, and 3B, all of which are structurally similar. Typically, elastases hydrolyze many proteins in addition to elastin. However, CELA3A has only little elastolytic activity. CELA3A is secreted by the pancreas and characterized by a digestive function in the intestine, very similar to other serine proteases such as trypsin, chymotrypsin and kallikrein. The protein contains GFP as fusion partner at the C-terminal end.
Molekulargewicht: 49,5 kDa
UniProt: P09093
Puffer: PBS
Reinheit: > 95% as determined by SDS-PAGE
Formulierung: liquid
Sequenz: YGPPSSHSSSR_VVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNKTPCYITGWGRLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAGGYIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNFIWKPTVFTRVSAFIDWIEETIASH
Formel: pH 7,4
SDS-Page of hCELA3A GFP/His-Tag
Structural model of hCELA3A GFP/His-Tag
Histogram of hCELA3A GFP/His-Tag