Furin, GFP/His-Tag, Human

Artikelnummer: TRZ-P2020-119_100
Artikelname: Furin, GFP/His-Tag, Human
Artikelnummer: TRZ-P2020-119_100
Hersteller Artikelnummer: P2020-119_100
Alternativnummer: TRZ-P2020-119_100
Hersteller: trenzyme
Wirt: Human
Kategorie: Biochemikalien
Applikation: ELISA, FA, WB
Spezies Reaktivität: Human
Alternative Synonym: Furin (Paired Basic Amino Acid Cleaving Enzyme), PCSK3, PACE, FUR, SPC1, Paired Basic Amino Acid Residue-Cleaving Enzyme, EC 3.4.21.75, Paired Basic Amino Acid Cleaving Enzyme (Furin, Membrane Associated Receptor Protein), Proprotein Convertase Subtilisin/Kexin, EC 3.4.21
Furin, also known as paired basic Amino acid Cleaving Enzyme (PACE) is a ubiquitous subtilisin-like proprotein convertase with a minimal cleavage site of Arg-X-X-Arg˅. However, the enzyme prefers the site Arg-X-Lys/Arg-Arg˅. It is the major processing enzyme of the secretory pathway and is localized in the trans-golgi network where it functions to cleave other proteins into their mature/active forms. Substrates of Furin include blood clotting factors, serum proteins and growth factor receptors such as the insulin-like growth factor receptor but also viral proteins like the SARS-CoV-2 Spike protein. Furin is inhibited by EGTA, alpha1- Antitrypsin Portland and polyarginine compounds.
Molekulargewicht: 103,7 kDa
UniProt: P09958
Puffer: PBS
Reinheit: > 85% as determined by SDS-PAGE
Formulierung: liquid
Sequenz: MQKVFTNTWAVRIPGGPAVANSVARKHGFLNLGQIFGDYYHFWHRGVTKRSLSPHRPRHSRLQREPQVQWLEQQVAKRRTKRDVYQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQ
Formel: pH 7,4
SDS-Page of Furin GFP/His-tag
Structural model of Furin GFP/His-tag
Histogram of Furin GFP/His-tag