Lanmodulin (LanM), E. coli

Artikelnummer: TRZ-P2020-126_1000
Artikelname: Lanmodulin (LanM), E. coli
Artikelnummer: TRZ-P2020-126_1000
Hersteller Artikelnummer: P2020-126_1000
Alternativnummer: TRZ-P2020-126_1000
Hersteller: trenzyme
Wirt: E. coli
Kategorie: Biochemikalien
Applikation: ELISA, FA, WB
Spezies Reaktivität: Bacteria
Alternative Synonym: Lanmodulin, Lanthanides, Lns
Lanthanides (Lns) are essential cofactors in certain enzymes. Lanmodulin (LanM) is a metal binding protein found in several lanthanide-utilizing, methylotrophic bacteria like Methylorubrum sp. The protein exhibits unique metal-binding properties and binds rare-earth elements (REEs) with very high affinity, often better than many synthetic chelators. LanM-REE complexes are stable at extreme conditions like high temperature, repeated acid treatments down to pH 2.5 and up to molar amounts of competing non-REE metal ions. Therefore, lanmodulin could be used even in harsh chemical processes for selective recovery of a broad range of REE from precumbustion coal and electronic waste leachates.
Molekulargewicht: 14,9 kDa
UniProt: B1ZIE8
Puffer: PBS
Reinheit: > 95% as determined by SDS-PAGE
Formulierung: liquid
Sequenz: MAFRLSSAVLLAALVAAPAYAAPTTTTKVDIAAFDPDKDGTIDLKEALAAGSAAFDKLDPDKDGTLDAKELKGRVSEADLKKLDPDNDGTLDKKEYLAAVEAQFKAANPDNDGTIDARELASPAGSALVNLIR
Formel: pH 7,4
SDS-Page of Lanmodulin lanM
Structural model of Lanmodulin lanM
Histogram of Lanmodulin lanM